gatamow219
gatamow219 gatamow219
  • 09-04-2021
  • Mathematics
contestada

Please Help!, Brainliest to whoever helps

Please Help Brainliest to whoever helps class=

Respuesta :

SoulMinder
SoulMinder SoulMinder
  • 09-04-2021
B for sure!!!!!!!!!!!!!!!!!!!
Answer Link

Otras preguntas

What would life be like without freedom of religion?
What symbols do composers use when notes go beyond the staff?A. Cliff Lines B. Many lines C. Ledger Lines​
I am writing a story and I need some more inspiration. A girl and her brother are following footprints they found in the woods. What should they lead to? All id
Find the distance between (2, 2) and (-4, 4). Round answer to the nearest tenth.
What could the Big Three have done differently?
describe your best friend at home to one of your teachers in the school and give three reasons why he is your best friend​
Annie bakes cookies and cupcakes in a ratio of 2 to 7 for her gift boxes. Her school needs 36 desserts to sell in a bake sale. How many cupcakes will
How can you modify your attitude towards a reading assignment you really do not want to do? Why is writing well important to you in college? Why is it a good id
physiology is the study of ​
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein